bio_tools 0.1.3

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion3, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Job name",
      "kind": "text",
      "default": "genie3-demo",
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "target_pdb",
      "label": "Target PDB",
      "kind": "file",
      "default": "HEADER    PASTE A TARGET PDB HERE",
      "required": true,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": ".pdb,.ent",
      "task": ""
    },
    {
      "name": "target_sequence",
      "label": "Target sequence",
      "kind": "textarea",
      "default": "MVTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP",
      "required": true,
      "help": "",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "target_selection",
      "label": "Target chain and residues",
      "kind": "text",
      "default": "A1-40",
      "required": true,
      "help": "Comma-separated PDB selections such as A1-40 or A2-158,B4-90.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "hotspots",
      "label": "Interface hotspots",
      "kind": "text",
      "default": "A10,A20,A30",
      "required": true,
      "help": "Comma-separated target chain/residue identifiers.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "minimum_length",
      "label": "Minimum binder length",
      "kind": "number",
      "default": 80,
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": 20,
      "maximum": 500,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "maximum_length",
      "label": "Maximum binder length",
      "kind": "number",
      "default": 120,
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": 20,
      "maximum": 500,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "num_samples",
      "label": "Binder candidates",
      "kind": "number",
      "default": 1,
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 1000,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    }
  ],
  "tasks": []
}