bio_tools 0.1.3

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion3, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Job name",
      "kind": "text",
      "default": "dlkcat-demo",
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "protein_sequence",
      "label": "Enzyme sequence",
      "kind": "textarea",
      "default": "MSEPAQKKQKVSNGGGSSNKRAADSLADQLYGKSAAAAHTPPAKKAKTETIAAPTFTTSGLDKLDLSNIDSSAWKQLAEEDLASLYGDLDSHRLDQPFPSAAAPVAKKRVSFTDSAAAA",
      "required": true,
      "help": "",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "substrate_smiles",
      "label": "Substrate SMILES",
      "kind": "textarea",
      "default": "OCC1OC(O)C(O)C(O)C1O",
      "required": true,
      "help": "The substrate as a SMILES string; DLKcat builds its molecular graph from this.",
      "options": [],
      "rows": 2,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "substrate_name",
      "label": "Substrate name",
      "kind": "text",
      "default": "D-glucose",
      "required": false,
      "help": "Carried through to the output for readability; it does not affect the prediction.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "additional_entries",
      "label": "Additional pairs (optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "More substrate/enzyme pairs to score in the same run, one per line, as name;SMILES;sequence.",
      "options": [],
      "rows": 4,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    }
  ],
  "tasks": []
}