bio_tools 0.1.3

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion3, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Job name",
      "kind": "text",
      "default": "esmfold2-demo",
      "required": false,
      "help": "Used to name the predicted mmCIF file.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 80,
      "accept": "",
      "task": "",
      "group": "Input"
    },
    {
      "name": "sequence_molecules",
      "label": "Molecules",
      "kind": "molecule_builder",
      "default": "[{\"type\": \"protein\", \"id\": \"A\", \"sequence\": \"MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLK\", \"modifications\": []}]",
      "required": true,
      "help": "Add one box per unique ESMFold2 entity. Set its ID (or comma-separated IDs for identical copies), sequence or ligand, zero-indexed residue modifications, and optional JSON-safe protein/RNA MSA value. Ligands may contain one or more comma-separated CCD_ codes.",
      "options": [
        {
          "value": "protein",
          "label": "Protein"
        },
        {
          "value": "ligand",
          "label": "Ligand"
        },
        {
          "value": "dna",
          "label": "DNA"
        },
        {
          "value": "rna",
          "label": "RNA"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters",
      "molecule_features": "id,zero_indexed_modifications,protein_msa,rna_msa,structured_msa,ligand_multiple_ccd"
    },
    {
      "name": "pocket",
      "label": "Pocket conditioning (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native ESMFold2 pocket object with binder_chain_id and contacts.",
      "options": [],
      "rows": 5,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "distogram_conditioning",
      "label": "Distogram conditioning (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native ESMFold2 distogram_conditioning array with chain_id and JSON matrix values.",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "covalent_bonds",
      "label": "Covalent bonds (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native ESMFold2 covalent_bonds array using chain_id, residue index, and atom index fields for each endpoint.",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "input_json",
      "label": "StructurePredictionInput (JSON)",
      "kind": "textarea",
      "default": "{\n  \"sequences\": [\n    {\n      \"type\": \"protein\",\n      \"id\": \"A\",\n      \"sequence\": \"MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLK\"\n    }\n  ]\n}",
      "required": true,
      "help": "JSON representation of ESMFold2's StructurePredictionInput. Sequence entries use type protein, dna, rna, or ligand; polymers take id and sequence, while ligands take id plus either smiles or a ccd list. Native pocket, distogram, covalent-bond, modification, and serialized MSA fields are passed through.",
      "options": [],
      "rows": 16,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "help_note": "Modification positions are zero-indexed, exactly as in the official ESMFold2 Python dataclass. Use the JSON-safe shape produced by serialize_structure_prediction_input.",
      "input_modes": "text"
    },
    {
      "name": "inputs_file",
      "label": "StructurePredictionInput file (JSON)",
      "kind": "file",
      "default": "",
      "required": false,
      "help": "The JSON file defining this prediction, in ESMFold2's own StructurePredictionInput format.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": ".json",
      "task": "",
      "group": "Input",
      "input_modes": "upload",
      "help_note": "Choose a file. Its contents are read here and sent as the input document."
    },
    {
      "name": "num_loops",
      "label": "Recycling loops",
      "kind": "number",
      "default": 20,
      "required": false,
      "help": "Recycling loops passed to ESMFold2InputBuilder.fold. The released API default is 20.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 64,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "num_sampling_steps",
      "label": "Diffusion sampling steps",
      "kind": "number",
      "default": 200,
      "required": false,
      "help": "Diffusion sampling steps passed to ESMFold2InputBuilder.fold. The released API default is 200.",
      "options": [],
      "rows": null,
      "minimum": 2,
      "maximum": 1000,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "num_diffusion_samples",
      "label": "Diffusion samples",
      "kind": "number",
      "default": 1,
      "required": false,
      "help": "Number of independently sampled structures. More than one produces one mmCIF per sample.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 16,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "seed",
      "label": "Random seed",
      "kind": "number",
      "default": 0,
      "required": false,
      "help": "Seeds input preparation and diffusion sampling.",
      "options": [],
      "rows": null,
      "minimum": 0,
      "maximum": 4294967295,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "lm_dropout",
      "label": "Language-model dropout",
      "kind": "number",
      "default": 0.3,
      "required": false,
      "help": "Inference-time LM embedding dropout. The released folding API defaults to 0.3; set 0 to disable it.",
      "options": [],
      "rows": null,
      "minimum": 0,
      "maximum": 1,
      "step": 0.01,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "chunk_size",
      "label": "Pair-operation chunk size",
      "kind": "number",
      "default": 64,
      "required": false,
      "help": "Chunk size for memory-heavy pair operations. The released model defaults to 64; smaller values use less memory. Set 0 to disable chunking.",
      "options": [],
      "rows": null,
      "minimum": 0,
      "maximum": 512,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Runtime"
    },
    {
      "name": "device",
      "label": "Device",
      "kind": "select",
      "default": "auto",
      "required": false,
      "help": "Auto selects CUDA when available and otherwise CPU. The published 6B model is intended for GPU inference.",
      "options": [
        {
          "value": "auto",
          "label": "Auto"
        },
        {
          "value": "cuda",
          "label": "CUDA"
        },
        {
          "value": "cpu",
          "label": "CPU"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Runtime"
    },
    {
      "name": "precision",
      "label": "Model precision",
      "kind": "select",
      "default": "default",
      "required": false,
      "help": "Use the checkpoint's published dtype, or explicitly cast model weights to BF16 or FP32.",
      "options": [
        {
          "value": "default",
          "label": "Checkpoint default"
        },
        {
          "value": "bf16",
          "label": "BF16"
        },
        {
          "value": "fp32",
          "label": "FP32"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Runtime"
    }
  ],
  "input_modes": {
    "name": "input_mode",
    "label": "Input mode",
    "default": "parameters",
    "options": [
      {
        "value": "parameters",
        "label": "Set parameters here"
      },
      {
        "value": "text",
        "label": "Enter YAML or JSON"
      },
      {
        "value": "upload",
        "label": "Upload YAML or JSON"
      }
    ]
  },
  "tasks": []
}