bio_tools 0.1.3

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion3, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Job name",
      "kind": "text",
      "default": "boltz2-demo",
      "required": false,
      "help": "Names the output directory for this run.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 80,
      "accept": "",
      "task": "",
      "group": "Input"
    },
    {
      "name": "sequence_molecules",
      "label": "Molecules",
      "kind": "molecule_builder",
      "default": "[{\"type\": \"protein\", \"id\": \"A\", \"sequence\": \"QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEIS\", \"msa\": \"empty\", \"cyclic\": false, \"modifications\": []}]",
      "required": true,
      "help": "Add one box per unique protein, ligand, DNA, or RNA entity. Set its native Boltz chain ID (or comma-separated IDs for identical copies), sequence or ligand, optional protein MSA, cyclic flag, and residue modifications.",
      "options": [
        {
          "value": "protein",
          "label": "Protein"
        },
        {
          "value": "ligand",
          "label": "Ligand"
        },
        {
          "value": "dna",
          "label": "DNA"
        },
        {
          "value": "rna",
          "label": "RNA"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters",
      "molecule_features": "id,cyclic,modifications,protein_msa"
    },
    {
      "name": "constraints",
      "label": "Constraints (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native Boltz constraints array. Supports bond, pocket, and contact entries using the chain IDs above.",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "templates",
      "label": "Templates (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native Boltz templates array. Each entry may select a CIF/PDB, chain mapping, force flag, and threshold.",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "properties",
      "label": "Properties (JSON, optional)",
      "kind": "textarea",
      "default": "",
      "required": false,
      "help": "Native Boltz properties array, such as [{\"affinity\": {\"binder\": \"B\"}}].",
      "options": [],
      "rows": 4,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "input_modes": "parameters"
    },
    {
      "name": "yaml_spec",
      "label": "Boltz input (YAML)",
      "kind": "textarea",
      "default": "version: 1\nsequences:\n  - protein:\n      id: A\n      sequence: QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEIS\n      msa: empty\n",
      "required": true,
      "help": "Complete native Boltz YAML. Define protein, DNA, RNA, and ligand entities under sequences; optional constraints, templates, and affinity properties use the same schema as the Boltz CLI.",
      "options": [],
      "rows": 16,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 500000,
      "accept": "",
      "task": "",
      "group": "Input",
      "help_note": "Bio Web writes this text to input.yaml and passes that file to boltz predict.",
      "input_modes": "text"
    },
    {
      "name": "inputs_file",
      "label": "Boltz input file (YAML)",
      "kind": "file",
      "default": "",
      "required": false,
      "help": "The YAML file defining this prediction, in the same schema as the Boltz CLI takes.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": ".yaml,.yml,.json",
      "task": "",
      "group": "Input",
      "input_modes": "upload",
      "help_note": "Choose a file. Its contents are read here and sent as the input document."
    },
    {
      "name": "use_msa_server",
      "label": "Use the public MSA server",
      "kind": "checkbox",
      "default": false,
      "required": false,
      "help": "Generate missing protein MSAs through Boltz's configured MMseqs2 server. Leave off when every protein supplies an MSA path or uses msa: empty.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "use_potentials",
      "label": "Use inference-time potentials",
      "kind": "checkbox",
      "default": false,
      "required": false,
      "help": "Apply Boltz-2 inference-time potentials to improve physical plausibility.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "recycling_steps",
      "label": "Recycling steps",
      "kind": "number",
      "default": 3,
      "required": false,
      "help": "Number of recycling steps. The Boltz CLI default is 3.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 20,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "sampling_steps",
      "label": "Structure sampling steps",
      "kind": "number",
      "default": 200,
      "required": false,
      "help": "Diffusion steps used for structure prediction. The Boltz CLI default is 200.",
      "options": [],
      "rows": null,
      "minimum": 10,
      "maximum": 1000,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "diffusion_samples",
      "label": "Structure samples",
      "kind": "number",
      "default": 1,
      "required": false,
      "help": "Independent diffusion samples generated for each input.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 50,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "step_scale",
      "label": "Structure step scale",
      "kind": "number",
      "default": 1.5,
      "required": false,
      "help": "Diffusion temperature/step size. Boltz-2 defaults to 1.5 and recommends values between 1 and 2; lower values increase diversity.",
      "options": [],
      "rows": null,
      "minimum": 0,
      "maximum": 5,
      "step": 0.01,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Inference"
    },
    {
      "name": "sampling_steps_affinity",
      "label": "Affinity sampling steps",
      "kind": "number",
      "default": 200,
      "required": false,
      "help": "Sampling steps for the affinity head. Used only when the YAML requests an affinity property.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 1000,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Affinity"
    },
    {
      "name": "diffusion_samples_affinity",
      "label": "Affinity samples",
      "kind": "number",
      "default": 5,
      "required": false,
      "help": "Diffusion samples for the affinity head. The Boltz CLI default is 5.",
      "options": [],
      "rows": null,
      "minimum": 1,
      "maximum": 50,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Affinity"
    },
    {
      "name": "affinity_mw_correction",
      "label": "Apply affinity molecular-weight correction",
      "kind": "checkbox",
      "default": false,
      "required": false,
      "help": "Enable Boltz's molecular-weight correction for the affinity value head.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Affinity"
    },
    {
      "name": "seed",
      "label": "Random seed",
      "kind": "number",
      "default": 0,
      "required": false,
      "help": "Seed used by the Boltz random-number generator.",
      "options": [],
      "rows": null,
      "minimum": 0,
      "maximum": 4294967295,
      "step": 1,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Output"
    },
    {
      "name": "output_format",
      "label": "Coordinate format",
      "kind": "select",
      "default": "mmcif",
      "required": false,
      "help": "Format of predicted coordinate files.",
      "options": [
        {
          "value": "mmcif",
          "label": "mmCIF"
        },
        {
          "value": "pdb",
          "label": "PDB"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": "",
      "group": "Output"
    }
  ],
  "input_modes": {
    "name": "input_mode",
    "label": "Input mode",
    "default": "parameters",
    "options": [
      {
        "value": "parameters",
        "label": "Set parameters here"
      },
      {
        "value": "text",
        "label": "Enter YAML or JSON"
      },
      {
        "value": "upload",
        "label": "Upload YAML or JSON"
      }
    ]
  },
  "tasks": []
}