bio_tools 0.1.3

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion3, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Antibody name",
      "kind": "text",
      "default": "mouse-4d5",
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "heavy_sequence",
      "label": "Heavy-chain sequence",
      "kind": "textarea",
      "default": "DVQLQESGPGLVRPSQTLSLTCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA",
      "required": true,
      "help": "Variable domain only. The placeholder is the murine 4D5 heavy chain, the mouse parent of trastuzumab.",
      "options": [],
      "rows": 7,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "light_sequence",
      "label": "Light-chain sequence",
      "kind": "textarea",
      "default": "DIVMTQSHKFMSTSVGDRVSITCKASQDVNTAVAWYQQKPGHSPKLLIYSASFRYTGVPDRFTGSRSGTDFTFTISSVQAEDLAVYYCQQHYTTPPTFGGGTKVEIK",
      "required": true,
      "help": "Variable domain only. The placeholder is the murine 4D5 light chain.",
      "options": [],
      "rows": 7,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "operation",
      "label": "Operation",
      "kind": "select",
      "default": "humanize",
      "required": false,
      "help": "",
      "options": [
        {
          "value": "humanize",
          "label": "Sapiens humanization"
        },
        {
          "value": "mean_score",
          "label": "Mean Sapiens score"
        },
        {
          "value": "oasis",
          "label": "OASis humanness"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    }
  ],
  "tasks": []
}