bio_tools 0.1.1

Install, run, and inspect computational biology and chemistry tools, e.g. AlphaFold, Boltz, RFdiffusion, and ProteinMPNN
Documentation
{
  "fields": [
    {
      "name": "job_name",
      "label": "Job name",
      "kind": "text",
      "default": "catpred-demo",
      "required": false,
      "help": "",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "parameter",
      "label": "Parameter",
      "kind": "select",
      "default": "kcat",
      "required": false,
      "help": "",
      "options": [
        {
          "value": "kcat",
          "label": "kcat (turnover number)"
        },
        {
          "value": "km",
          "label": "Km (Michaelis constant)"
        },
        {
          "value": "ki",
          "label": "Ki (inhibition constant)"
        }
      ],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "protein_sequence",
      "label": "Enzyme sequence",
      "kind": "textarea",
      "default": "MSEPAQKKQKVSNGGGSSNKRAADSLADQLYGKSAAAAHTPPAKKAKTETIAAPTFTTSGLDKLDLSNIDSSAWKQLAEEDLASLYGDLDSHRLDQPFPSAAAPVAKKRVSFTDSAAAA",
      "required": true,
      "help": "",
      "options": [],
      "rows": 6,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "substrate_smiles",
      "label": "Substrate SMILES",
      "kind": "textarea",
      "default": "OCC1OC(O)C(O)C(O)C1O",
      "required": true,
      "help": "For a Ki prediction this is the inhibitor rather than the substrate.",
      "options": [],
      "rows": 2,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    },
    {
      "name": "ec_number",
      "label": "EC number (optional)",
      "kind": "text",
      "default": "",
      "required": false,
      "help": "For example 2.7.1.1. Used as a feature where the model has one.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 20,
      "accept": "",
      "task": ""
    },
    {
      "name": "organism",
      "label": "Organism (optional)",
      "kind": "text",
      "default": "",
      "required": false,
      "help": "For example Escherichia coli.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": 200,
      "accept": "",
      "task": ""
    },
    {
      "name": "include_uncertainty",
      "label": "Return the predicted uncertainty",
      "kind": "checkbox",
      "default": true,
      "required": false,
      "help": "Lower predicted variance goes with higher accuracy, so this is worth keeping on.",
      "options": [],
      "rows": null,
      "minimum": null,
      "maximum": null,
      "step": null,
      "maxlength": null,
      "accept": "",
      "task": ""
    }
  ],
  "tasks": []
}