{
"fields": [
{
"name": "job_name",
"label": "Job name",
"kind": "text",
"default": "boltz2-demo",
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "sequence_molecules",
"label": "Molecules",
"kind": "molecule_builder",
"default": "[{\"type\": \"protein\", \"sequence\": \"MVTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP\", \"cyclic\": false, \"modifications\": []}]",
"required": true,
"help": "Add one box per chain: Protein, Ligand, DNA, or RNA. Ligands take a SMILES string or a CCD_ code (e.g. CCD_ATP). A modification applies a CCD residue code at a given position; \"Cyclic\" marks the chain cyclic.",
"options": [
{
"value": "protein",
"label": "Protein"
},
{
"value": "ligand",
"label": "Ligand"
},
{
"value": "dna",
"label": "DNA"
},
{
"value": "rna",
"label": "RNA"
}
],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "sequence"
},
{
"name": "proteins",
"label": "Protein chains",
"kind": "textarea",
"default": "MVTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP",
"required": true,
"help": "One protein chain sequence per line.",
"options": [],
"rows": 6,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list"
},
{
"name": "dnas",
"label": "DNA chains (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "One DNA chain sequence per line.",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list"
},
{
"name": "rnas",
"label": "RNA chains (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "One RNA chain sequence per line.",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list"
},
{
"name": "molecules",
"label": "Molecules",
"kind": "textarea",
"default": "[{\"type\": \"protein\", \"chain\": \"A\", \"sequence\": \"MVTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP\"}]",
"required": true,
"help": "JSON list of {\"type\": \"protein\"|\"dna\"|\"rna\", \"chain\": \"A\", \"sequence\": \"...\"}.",
"options": [],
"rows": 6,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "molecules"
},
{
"name": "yaml_spec",
"label": "Design specification (YAML)",
"kind": "textarea",
"default": "version: 1\nsequences:\n - protein:\n id: A\n sequence: MVTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFP\n msa: empty\n",
"required": true,
"help": "A complete Boltz YAML input, used as-is (ligands, bonds, restraints, templates below are ignored for this task).",
"options": [],
"rows": 10,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "yaml"
},
{
"name": "ligands",
"label": "Ligands (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "One ligand per line: a SMILES string, or CCD_<code> for a CCD component.",
"options": [],
"rows": 3,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list,molecules,yaml"
},
{
"name": "affinity",
"label": "Predict affinity of the first ligand",
"kind": "checkbox",
"default": true,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "cyclic",
"label": "Treat protein chains as cyclic",
"kind": "checkbox",
"default": false,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list,molecules,yaml"
},
{
"name": "use_msa_server",
"label": "Use the public MSA server",
"kind": "checkbox",
"default": false,
"required": false,
"help": "Opt in to a network call to ColabFold's MMseqs2 server for better accuracy. Off by default keeps the run local (single-sequence mode).",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "use_potentials",
"label": "Use inference-time potentials",
"kind": "checkbox",
"default": false,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "recycling_steps",
"label": "Recycling steps",
"kind": "number",
"default": 3,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": 1,
"maximum": 20,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "sampling_steps",
"label": "Diffusion sampling steps",
"kind": "number",
"default": 200,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": 10,
"maximum": 1000,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "diffusion_samples",
"label": "Diffusion samples",
"kind": "number",
"default": 1,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": 1,
"maximum": 50,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "step_scale",
"label": "Step scale (optional)",
"kind": "number",
"default": 0,
"required": false,
"help": "Diffusion temperature; lower increases diversity. Leave at 0 for Boltz's own default (~1.5).",
"options": [],
"rows": null,
"minimum": 0,
"maximum": 5,
"step": 0.01,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "seed",
"label": "Random seed",
"kind": "number",
"default": 0,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": 0,
"maximum": 2147483647,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "output_format",
"label": "Output format",
"kind": "select",
"default": "mmcif",
"required": false,
"help": "",
"options": [
{
"value": "mmcif",
"label": "mmCIF"
},
{
"value": "pdb",
"label": "PDB"
}
],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "bonds",
"label": "Covalent bonds (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "JSON list, e.g. [{\"atom1Chain\":\"A\",\"atom1Idx\":32,\"atom1Atom\":\"C\",\"atom2Chain\":\"B\",\"atom2Idx\":1,\"atom2Atom\":\"N\"}].",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "pocket_restraints",
"label": "Pocket restraints (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "JSON list, e.g. [{\"binderChain\":\"A\",\"pocketChain\":\"B\",\"pocketContacts\":\"5 6 7\",\"maxDistance\":6,\"force\":false}].",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "contact_restraints",
"label": "Contact restraints (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "JSON list, e.g. [{\"chainA\":\"A\",\"res_idxA\":1,\"chainB\":\"B\",\"res_idxB\":1,\"max_distance_angstrom\":5,\"force\":false}].",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "modifications",
"label": "Residue modifications (optional)",
"kind": "textarea",
"default": "",
"required": false,
"help": "JSON list, e.g. [{\"chain\":\"A\",\"ptmPosition\":15,\"ptmResidue\":\"SEP\"}].",
"options": [],
"rows": 2,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": "list,molecules,yaml"
},
{
"name": "template_cif",
"label": "Template structure (mmCIF, optional)",
"kind": "file",
"default": "",
"required": false,
"help": "Uploaded mmCIF file used to template the prediction.",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": ".cif,.mmcif",
"task": ""
},
{
"name": "template_chain_ids",
"label": "Template applies to chains (optional)",
"kind": "text",
"default": "",
"required": false,
"help": "Comma-separated chain letters from above; blank matches automatically.",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "template_ids",
"label": "Template chain IDs (optional)",
"kind": "text",
"default": "",
"required": false,
"help": "Comma-separated chain IDs inside the template mmCIF, aligned with the chains above.",
"options": [],
"rows": null,
"minimum": null,
"maximum": null,
"step": null,
"maxlength": null,
"accept": "",
"task": ""
},
{
"name": "template_threshold",
"label": "Template distance threshold, angstrom (optional)",
"kind": "number",
"default": 0,
"required": false,
"help": "",
"options": [],
"rows": null,
"minimum": 0,
"maximum": 20,
"step": 0.1,
"maxlength": null,
"accept": "",
"task": ""
}
],
"tasks": [
{
"value": "sequence",
"label": "Sequence"
},
{
"value": "list",
"label": "Chain list"
},
{
"value": "molecules",
"label": "Molecules (JSON)"
},
{
"value": "yaml",
"label": "YAML configuration"
}
]
}