proteinogenic 0.2.0

Chemical structure generation for protein sequences as SMILES string
Documentation

proteinogenic Star me

Chemical structure generation for protein sequences as SMILES string.

Actions Codecov License Source Crate Documentation Changelog GitHub issues

🔌 Usage

This crate builds on top of purr, a crate providing primitives for reading and writing SMILES.

Use the AminoAcid enum to encode the sequence residues, and build a SMILES string with proteinogenic::smiles. For example with divergicin 750:

extern crate proteinogenic;

let residues = "KGILGKLGVVQAGVDFVSGVWAGIKQSAKDHPNA"
  .chars()
  .map(proteinogenic::AminoAcid::from_char)
  .map(Result::unwrap);
let s = proteinogenic::smiles(residues)
  .expect("failed to generate SMILES string");

Additional modifications can be carried out by using a Peptide struct to configure the rendering of the peptide. So far, disulfide bonds as well as lanthionine bridges are supported, as well as head-to-tail cyclization. For instance. we can generate the SMILES string of a cyclotide such as kalata B1:

extern crate proteinogenic;

let residues = "GLPVCGETCVGGTCNTPGCTCSWPVCTRN"
  .chars()
  .map(proteinogenic::AminoAcid::from_char)
  .map(Result::unwrap);

let mut p = proteinogenic::Protein::new(residues);
p.cyclization(proteinogenic::Cyclization::HeadToTail);
p.cross_link(proteinogenic::CrossLink::Cystine(5, 19)).unwrap();
p.cross_link(proteinogenic::CrossLink::Cystine(9, 21)).unwrap();
p.cross_link(proteinogenic::CrossLink::Cystine(14, 26)).unwrap();

let s = p.smiles()
  .expect("failed to generate SMILES string");

This SMILES string can be used in conjunction with other cheminformatics toolkits, for instance OpenBabel which can generate a PNG figure:

Skeletal formula of divergicin 750

Note that proteinogenic is not limited to building a SMILES string; it can actually use any purr::walk::Follower implementor to generate an in-memory representation of a protein formula. If your code is already compatible with purr, then you'll be able to use protein sequences quite easily.

extern crate proteinogenic;
extern crate purr;

let sequence = "KGILGKLGVVQAGVDFVSGVWAGIKQSAKDHPNA";
let residues = sequence.chars()
  .map(proteinogenic::AminoAcid::from_char)
  .map(Result::unwrap);

let mut builder = purr::graph::Builder::new();
proteinogenic::visit(residues, &mut builder);

builder.build()
  .expect("failed to create a graph representation");

The API is not yet stable, and may change to follow changes introduced by purr or to improve the interface ergonomics.

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

📋 Changelog

This project adheres to Semantic Versioning and provides a changelog in the Keep a Changelog format.

🔍 See Also

If you're a bioinformatician and a Rustacean, you may be interested in these other libraries:

  • uniprot.rs: Rust data structures for the UniProtKB databases.
  • obofoundry.rs: Rust data structures for the OBO Foundry.
  • fastobo: Rust parser and abstract syntax tree for Open Biomedical Ontologies.
  • pubchem.rs: Rust data structures and API client for the PubChem API.

📜 License

This library is provided under the open-source MIT license.

This project was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.